PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OPUNC03G01630.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MIKC_MADS
Protein Properties Length: 420aa    MW: 47546.4 Da    PI: 10.4123
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OPUNC03G01630.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF93.69.4e-30149199151
                      S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
           SRF-TF   1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 
                      krien + rqvtfskRrng+lKKA+ELSvLCdaeva+i+fs++gklye++s
  OPUNC03G01630.1 149 KRIENPTSRQVTFSKRRNGLLKKAFELSVLCDAEVALIVFSPRGKLYEFAS 199
                      79***********************************************86 PP

2K-box65.22.3e-222803621799
            K-box  17 lqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkle 99 
                       + +++ L k++e L+  +R+llGe+Le++s++eL++Le +Le+sl +iR +K++ll eq+ +l++ke +l+++n++Lr+k +
  OPUNC03G01630.1 280 IKADAEGLAKKLEALEAYKRKLLGEKLEECSIEELHSLEVKLERSLISIRGRKTKLLEEQVAKLREKEMKLRKDNEELREKCK 362
                      5678899*************************************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004329.8E-41141200IPR002100Transcription factor, MADS-box
PROSITE profilePS5006631.595141201IPR002100Transcription factor, MADS-box
PROSITE patternPS003500143197IPR002100Transcription factor, MADS-box
SuperFamilySSF554552.49E-28143201IPR002100Transcription factor, MADS-box
CDDcd002654.24E-35143199No hitNo description
PRINTSPR004042.4E-30143163IPR002100Transcription factor, MADS-box
PfamPF003195.7E-27150197IPR002100Transcription factor, MADS-box
PRINTSPR004042.4E-30163178IPR002100Transcription factor, MADS-box
PRINTSPR004042.4E-30178199IPR002100Transcription factor, MADS-box
PROSITE profilePS5129713.098277367IPR002487Transcription factor, K-box
PfamPF014867.1E-23279362IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 420 aa     Download sequence    Send to blast
MHYHFYPSVA IMIKNGNATG IPPVSFSFAF AFSTALPASS PTAVATTRTK GNGNTSRDQK  60
GKPRRREGEG GGGLGDRWGE REREGKGGRG EERKEQLLGY GQTLQRLHHH SLPFLLHLSP  120
LLLLLLRRAG AVHRRPGRSK MVRGKTQMKR IENPTSRQVT FSKRRNGLLK KAFELSVLCD  180
AEVALIVFSP RGKLYEFASA RKIWSEKTAK TIFPRMAIEL PSKQSHDFHK EINCETGKKT  240
IERYRTYTKE NIGNKTVQQD IEESVFNSPR MWIALEIMQI KADAEGLAKK LEALEAYKRK  300
LLGEKLEECS IEELHSLEVK LERSLISIRG RKTKLLEEQV AKLREKEMKL RKDNEELREK  360
CKNQPAMSAP SSVRAEDENP DRNINTTNDE MDVETELFIG LPGRSRSSGA AEDSRAKPHS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3p57_J2e-16143200259Myocyte-specific enhancer factor 2A
3p57_I2e-16143200259Myocyte-specific enhancer factor 2A
3p57_D2e-16143200259Myocyte-specific enhancer factor 2A
3p57_C2e-16143200259Myocyte-specific enhancer factor 2A
3p57_B2e-16143200259Myocyte-specific enhancer factor 2A
3p57_A2e-16143200259Myocyte-specific enhancer factor 2A
3kov_J2e-16143200259Myocyte-specific enhancer factor 2A
3kov_I2e-16143200259Myocyte-specific enhancer factor 2A
3kov_B2e-16143200259Myocyte-specific enhancer factor 2A
3kov_A2e-16143200259Myocyte-specific enhancer factor 2A
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY5519140.0AY551914.1 Oryza sativa (japonica cultivar-group) MADS-box protein RMADS208 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015630979.11e-140PREDICTED: MADS-box transcription factor 50
SwissprotQ9XJ601e-142MAD50_ORYSJ; MADS-box transcription factor 50
TrEMBLA0A0E0K8330.0A0A0E0K833_ORYPU; Uncharacterized protein
STRINGORGLA03G0015400.11e-136(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP14133379
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45660.17e-59AGAMOUS-like 20